Anti-ABP1/AOC1 Antibody Picoband™

ABP1/AOC1 antibody

Boster Bio Anti-ABP1/AOC1 Antibody Picoband™ catalog # PB10040. Tested in IF, IHC, ICC, WB applications. This antibody reacts with Human, Monkey.

Product Info Summary

SKU: PB10040
Size: 100 μg/vial
Reactive Species: Human, Monkey
Host: Rabbit
Application: IF, IHC, ICC, WB

Product Name

Anti-ABP1/AOC1 Antibody Picoband™

View all ABP1/AOC1 Antibodies

SKU/Catalog Number

PB10040

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-ABP1/AOC1 Antibody Picoband™ catalog # PB10040. Tested in IF, IHC, ICC, WB applications. This antibody reacts with Human, Monkey.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-ABP1/AOC1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10040)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human ABP1, different from the related mouse sequence by ten amino acids, and from the related rat sequence by eight amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB10040 is reactive to AOC1 in Human, Monkey

Applications

PB10040 is guaranteed for IF, IHC, ICC, WB Boster Guarantee

Observed Molecular Weight

85 kDa

Calculated molecular weight

85.378kDa

Background of ABP1/AOC1

This gene encodes a metal-binding membrane glycoprotein that oxidatively deaminates putrescine, histamine, and related compounds. The encoded protein is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Catalyzes the degradation of compounds such as putrescine, histamine, spermine, and spermidine, substances involved in allergic and immune responses, cell proliferation, tissue differentiation, tumor formation, and possibly apoptosis. Placental DAO is thought to play a role in the regulation of the female reproductive function.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Monkey
Immunohistochemistry(Paraffin-embedded Section), 2-5 μg/ml, Human
Flow Cytometry, 1-3 μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For AOC1 (Source: Uniprot.org, NCBI)

Gene Name

AOC1

Full Name

Amiloride-sensitive amine oxidase [copper-containing]

Weight

85.378kDa

Superfamily

copper/topaquinone oxidase family

Alternative Names

ABP; ABP1; amiloride binding protein 1 (amine oxidase (copper-containing)); Amiloride-binding protein; amiloride-sensitive amine oxidase [copper-containing]; amiloride-sensitive amine oxidase; AOC1; AOC1DAOamiloride-binding protein-1; DAO1; Diamine Oxidase; EC 1.4.3; EC 1.4.3.22; Histaminase; KAO; Kidney amine oxidase AOC1 ABP, ABP1, DAO, DAO1, KAO amine oxidase copper containing 1 amiloride-sensitive amine oxidase [copper-containing]|amiloride binding protein 1 (amine oxidase (copper-containing))|amiloride-binding protein 1|amiloride-sensitive amine oxidase|amine oxidase copper domain-containing protein 1|diamine oxidase|histaminase|kidney amine oxidase

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on AOC1, check out the AOC1 Infographic

AOC1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for AOC1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB10040

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-ABP1/AOC1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-ABP1/AOC1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

3 Customer Q&As for Anti-ABP1/AOC1 Antibody Picoband™

Question

Is this PB10040 anti-ABP1/AOC1 antibody reactive to the isotypes of AOC1?

Verified Customer

Verified customer

Asked: 2020-04-28

Answer

The immunogen of PB10040 anti-ABP1/AOC1 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human ABP1 (144-180aa STAEYALLYHTLQEATKPLHQFFLNTTGFSFQDCHDR), different from the related mouse sequence by ten amino acids, and from the related rat sequence by eight amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-04-28

Question

We are currently using anti-ABP1/AOC1 antibody PB10040 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, rat. Is it possible that the antibody can work on monkey tissues as well?

Verified Customer

Verified customer

Asked: 2019-08-07

Answer

The anti-ABP1/AOC1 antibody (PB10040) has not been validated for cross reactivity specifically with monkey tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-08-07

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for kidney using anti-ABP1/AOC1 antibody PB10040. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2018-04-11

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-04-11

Order DetailsPrice
PB10040

100μg

$370
PB10040-10ug

10μg sample (liquid)

$99
PB10040-Biotin

100 μg Biotin conjugated

$570
PB10040-Cy3

100 μg Cy3 conjugated

$570
PB10040-Dylight488

100 μg Dylight488 conjugated

$570
PB10040-Dylight550

100 μg Dylight550 conjugated

$570
PB10040-Dylight594

100 μg Dylight594 conjugated

$570
PB10040-FITC

100 μg FITC conjugated

$570
PB10040-HRP

100 μg HRP conjugated

$570
PB10040-APC

100 μg APC conjugated

$670
PB10040-PE

100 μg PE conjugated

$670
PB10040-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB10040
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.